Improve Research Reproducibility A Bio-protocol resource
bpdetail_icon_lock
Preprint

Antibody sequences

YW Yan Wu
FG Feng Gao
GG George F. Gao

Last updated date: Feb 25, 2021 Views: 962 Forks: 0

original An abbreviated version of this protocol was published in Science in Jun, 2020
A noncompeting pair of human neutralizing antibodies block COVID-19 virus binding to its receptor ACE2
download pdf Download PDF
ask Ask a question
cite How to cite
nfavorite Favorite

The amino acid sequences in the variable regions of B38 and H4 are listed below. 

B38-VH: EVQLVESGGGLVQPGGSLRLSCAASGFIVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRHNSKNTLYLQMNSLRAEDTAVYYCAREAYGMDVWGQGTTVTVSS 

B38-VL: DIVMTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPPYTFGQGTKLEIK 

H4-VH: 

QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGRINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARVPYCSSTSCHRDWYFDLWGRGTLVTVSS

 

H4-VL: 

DIQMTQSPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFPLTFGGGTKVEIK 

Copyright: Content may be subjected to copyright.
How to cite：
Readers should cite both the Bio-protocol preprint and the original research article where this protocol was used:
  1. Wu, Y, Gao, F and Gao, G F(2021). Antibody sequences. Bio-protocol Preprint. bio-protocol.org/prep880.
  2. Wu, Y., Wang, F., Shen, C., Peng, W., Li, D., Zhao, C., Li, Z., Li, S., Bi, Y., Yang, Y., Gong, Y., Xiao, H., Fan, Z., Tan, S., Wu, G., Tan, W., Lu, X., Fan, C., Wang, Q., Liu, Y., Zhang, C., Qi, J., Gao, G. F., Gao, F. and Liu, L.(2020). A noncompeting pair of human neutralizing antibodies block COVID-19 virus binding to its receptor ACE2 . Science 368(6496). DOI: 10.1126/science.abc2241

Do you have any questions about this protocol?

Post your question to gather feedback from the community. We will also invite the authors of this article to respond.

0/150

tip Tips for asking effective questions

+ Description

Write a detailed description. Include all information that will help others answer your question including experimental processes, conditions, and relevant images.

post Post a Question
0 Q&A
This protocol preprint was submitted via the "Request a Protocol" track.