The importin plasmids were either obtained directly from the human complementary DNA (cDNA) library as in pLX307 vector or cloned into pCDH vector with a C-terminal V5 tag. BIMAX2 (RRRRRRKRKREWDDDDDPPKKRRRLD) (29) and M9M (GGSYNDFGNYNNQSSNFGPMKGGNFGGRFEPYANPTKR) (30) were cloned into pEGFP-C2 vector to enable the expression of N-terminal EGFP fusion proteins. RTA-RFP was prepared by cloning of RTA into a modified pcDNA3 vector containing a C-terminal RFP sequence.

Note: The content above has been extracted from a research article, so it may not display correctly.



Q&A
Please log in to submit your questions online.
Your question will be posted on the Bio-101 website. We will send your questions to the authors of this protocol and Bio-protocol community members who are experienced with this method. you will be informed using the email address associated with your Bio-protocol account.



We use cookies on this site to enhance your user experience. By using our website, you are agreeing to allow the storage of cookies on your computer.